Structure of PDB 1z9c Chain B Binding Site BS01

Receptor Information

>1z9c Chain B (length=137) Species: 1423 (Bacillus subtilis)

MKLENQLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWEHETLTV
KKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALL
KEKAVDIPGTILGLSKQSGEDLKQLKSALYTLLETLH

Ligand information

>1z9c Chain G (length=29)

tacaatttaattgtatacaatttaattgt

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1z9c Structure of an OhrR-ohrA Operator Complex Reveals the DNA Binding Mechanism of the MarR Family.
• Resolution: 2.64 Å
• Binding residue (original residue number in PDB): T39 P41 Q42 G69 T70 M74 R77 D92 E93 R94
• Binding residue (residue number reindexed from 1): T32 P34 Q35 G62 T63 M67 R70 D85 E86 R87
• Binding affinity: PDBbind-CN: Kd=2.5nM

Gene Ontology

Molecular Function

• GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
• GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity

Biological Process

• GO:0000122 negative regulation of transcription by RNA polymerase II
• GO:0006355 regulation of DNA-templated transcription
• GO:0006950 response to stress
• GO:0042542 response to hydrogen peroxide
• GO:0045892 negative regulation of DNA-templated transcription

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1z9c, PDBe:1z9c, PDBj:1z9c
• PDBsum: 1z9c
• PubMed: 16209951
• UniProt: O34777|OHRR_BACSU Organic hydroperoxide resistance transcriptional regulator (Gene Name=ohrR)