Structure of PDB 1z56 Chain B Binding Site BS01

Receptor Information
>1z56 Chain B (length=76) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FEMADKLYKDICCVNDSYRNIKESDSSNRNRVEQLARERELLDKLLETRD
ERTRAMMVTLLNEKKKKIRELHEILR
Ligand information
>1z56 Chain K (length=13) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PPPPGPPPPPPPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1z56 Structure of an Xrcc4-DNA ligase IV yeast ortholog complex reveals a novel BRCT interaction mode.
Resolution3.92 Å
Binding residue
(original residue number in PDB)		M158 K161
Binding residue
(residue number reindexed from 1)		M3 K6
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1z56, PDBe:1z56, PDBj:1z56
PDBsum1z56
PubMed16388993
UniProtP53150|LIF1_YEAST Ligase-interacting factor 1 (Gene Name=LIF1)

[Back to BioLiP]