Structure of PDB 1yvl Chain B Binding Site BS01

Receptor Information
>1yvl Chain B (length=653) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVS
FATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQM
SMIIYSCLKEERKILENAQRFNMLDKQKELDSKVRNVKDKVMCIEHEIKS
LEDLQDEYDFKCKTLQNREHDQKQEQLLLKKMYLMLDNKRKEVVHKIIEL
LNVTELTQNALINDELVEWKRRQQSACIGGPPNACLDQLQNWFTIVAESL
QQVRQQLKKLEELEQKYTYEHDPITKNKQVLWDRTFSLFQQLIQSSFVVE
RQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKVKVLFDKDVNE
RNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQGPLIVTEE
LHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVA
EPRNLSFFLTPPCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGP
NASPDGLIPWTRFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIM
GFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSNGGEPDFHA
VEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKY
YSR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1yvl Structural bases of unphosphorylated STAT1 association and receptor binding.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R1602 S1604 E1605 S1606 H1629 A1630 V1631 E1632 P1633 Y1634 Y1651
Binding residue
(residue number reindexed from 1)		R573 S575 E576 S577 H599 A600 V601 E602 P603 Y604 Y621
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001222 transcription corepressor binding
GO:0001223 transcription coactivator binding
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005164 tumor necrosis factor receptor binding
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0031730 CCR5 chemokine receptor binding
GO:0035035 histone acetyltransferase binding
GO:0042393 histone binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0043565 sequence-specific DNA binding
GO:0044389 ubiquitin-like protein ligase binding
GO:0045296 cadherin binding
GO:0051721 protein phosphatase 2A binding
GO:1990841 promoter-specific chromatin binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0001937 negative regulation of endothelial cell proliferation
GO:0002053 positive regulation of mesenchymal cell proliferation
GO:0002230 positive regulation of defense response to virus by host
GO:0003340 negative regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006952 defense response
GO:0007165 signal transduction
GO:0007259 cell surface receptor signaling pathway via JAK-STAT
GO:0007584 response to nutrient
GO:0008015 blood circulation
GO:0008284 positive regulation of cell population proliferation
GO:0009410 response to xenobiotic stimulus
GO:0009612 response to mechanical stimulus
GO:0014070 response to organic cyclic compound
GO:0016525 negative regulation of angiogenesis
GO:0032727 positive regulation of interferon-alpha production
GO:0032869 cellular response to insulin stimulus
GO:0033209 tumor necrosis factor-mediated signaling pathway
GO:0034097 response to cytokine
GO:0034341 response to type II interferon
GO:0035456 response to interferon-beta
GO:0035458 cellular response to interferon-beta
GO:0038111 interleukin-7-mediated signaling pathway
GO:0038113 interleukin-9-mediated signaling pathway
GO:0042127 regulation of cell population proliferation
GO:0042542 response to hydrogen peroxide
GO:0042981 regulation of apoptotic process
GO:0043124 negative regulation of canonical NF-kappaB signal transduction
GO:0043434 response to peptide hormone
GO:0043542 endothelial cell migration
GO:0045648 positive regulation of erythrocyte differentiation
GO:0045893 positive regulation of DNA-templated transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0046725 negative regulation by virus of viral protein levels in host cell
GO:0048661 positive regulation of smooth muscle cell proliferation
GO:0051591 response to cAMP
GO:0051607 defense response to virus
GO:0051770 positive regulation of nitric-oxide synthase biosynthetic process
GO:0060333 type II interferon-mediated signaling pathway
GO:0060337 type I interferon-mediated signaling pathway
GO:0061326 renal tubule development
GO:0070106 interleukin-27-mediated signaling pathway
GO:0071345 cellular response to cytokine stimulus
GO:0071346 cellular response to type II interferon
GO:0071407 cellular response to organic cyclic compound
GO:0072136 metanephric mesenchymal cell proliferation involved in metanephros development
GO:0072162 metanephric mesenchymal cell differentiation
GO:0072308 negative regulation of metanephric nephron tubule epithelial cell differentiation
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0030424 axon
GO:0030425 dendrite
GO:0032991 protein-containing complex
GO:0048471 perinuclear region of cytoplasm
GO:0070721 ISGF3 complex
GO:0090575 RNA polymerase II transcription regulator complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1yvl, PDBe:1yvl, PDBj:1yvl
PDBsum1yvl
PubMed15780933
UniProtP42224|STAT1_HUMAN Signal transducer and activator of transcription 1-alpha/beta (Gene Name=STAT1)

[Back to BioLiP]