Structure of PDB 1yrn Chain B Binding Site BS01

Receptor Information
>1yrn Chain B (length=78) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIK
NWVSNRRRKEKTITIAPELADLLSGEPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1yrn Crystal structure of the MATa1/MAT alpha 2 homeodomain heterodimer bound to DNA.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y131 R132 G133 R135 Y156 R184 R185 K188
Binding residue
(residue number reindexed from 1)		Y4 R5 G6 R8 Y29 R57 R58 K61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1yrn, PDBe:1yrn, PDBj:1yrn
PDBsum1yrn
PubMed7569974
UniProtP0CY08|MTAL2_YEAST Mating-type protein ALPHA2 (Gene Name=MATALPHA2)

[Back to BioLiP]