Structure of PDB 1ymm Chain B Binding Site BS01

Receptor Information
>1ymm Chain B (length=178) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTE
LGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVY
PSLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVML
ETVPRSGEVYTCQVEHPSVTSPLTVEWR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ymm Unconventional topology of self peptide-major histocompatibility complex binding by a human autoimmune T cell receptor.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		R13 F26 D28 P56 D57 Y60 I67 Y78 H81 N82
Binding residue
(residue number reindexed from 1)		R11 F24 D26 P54 D55 Y58 I65 Y76 H79 N80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ymm, PDBe:1ymm, PDBj:1ymm
PDBsum1ymm
PubMed15821740
UniProtP01911|DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain (Gene Name=HLA-DRB1)

[Back to BioLiP]