Structure of PDB 1xvp Chain B Binding Site BS01

Receptor Information
>1xvp Chain B (length=246) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQFRPPAHLFIHHQPLPTLA
PVLPLVTHFADINTFMVLQVIKFTKDLPVFRSLPIEDQISLLKGAAVEIC
HIVLNTTFCLQTQNFLCGPLRYTIEDGARVGFQVEFLELLFHFHGTLRKL
QLQEPEYVLLAAMALFSPDRPGVTQRDEIDQLQEEMALTLQSYIKGQQRR
PRDRFLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1xvp A Structural Basis for Constitutive Activity in the Human CAR/RXRalpha Heterodimer.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		K177 R183 Q190 I191 K195 L342 E345
Binding residue
(residue number reindexed from 1)		K75 R81 Q88 I89 K93 L240 E243
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1xvp, PDBe:1xvp, PDBj:1xvp
PDBsum1xvp
PubMed15610735
UniProtQ14994|NR1I3_HUMAN Nuclear receptor subfamily 1 group I member 3 (Gene Name=NR1I3)

[Back to BioLiP]