Structure of PDB 1xso Chain B Binding Site BS01

Receptor Information

>1xso Chain B (length=150) Species: 8355 (Xenopus laevis)

VKAVCVLAGSGDVKGVVHFEQQDEGAVSVEGKIEGLTDGLHGFHIHVFGD
NTNGCMSAGSHFNPENKNHGAPGDTDRHVGDLGNVTAEGGVAQFKITDSL
ISLKGPNSIIGRTAVVHEKADDLGKGGNDESLKTGNAGGRLACGVIGYSP

Ligand information

• Ligand ID: CU
• InChI: InChI=1S/Cu/q+2
• InChIKey: JPVYNHNXODAKFH-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Cu+2]
  CACTVS 3.341: [Cu++]
• Formula: Cu
• Name: COPPER (II) ION
• DrugBank: DB14552
• PDB chain: 1xso Chain B Residue 152

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1xso Three-dimensional structure of Xenopus laevis Cu,Zn superoxide dismutase b determined by X-ray crystallography at 1.5 A resolution.
• Resolution: 1.49 Å
• Binding residue (original residue number in PDB): H44 H46 H61 H118
• Binding residue (residue number reindexed from 1): H44 H46 H61 H117
• Annotation score: 1

Enzymatic activity

• Catalytic site (original residue number in PDB): H44 H46 H61 H69 H78 D81 H118 R141
• Catalytic site (residue number reindexed from 1): H44 H46 H61 H69 H78 D81 H117 R140
• Enzyme Commision number: 1.15.1.1: superoxide dismutase.

Gene Ontology

Molecular Function

• GO:0004784 superoxide dismutase activity
• GO:0005507 copper ion binding
• GO:0016209 antioxidant activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006801 superoxide metabolic process
• GO:0019430 removal of superoxide radicals
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005777 peroxisome
• GO:0005829 cytosol

External links

• PDB: RCSB:1xso, PDBe:1xso, PDBj:1xso
• PDBsum: 1xso
• PubMed: 15299740
• UniProt: P15107|SOD1B_XENLA Superoxide dismutase [Cu-Zn] B (Gene Name=sod1-b)