Structure of PDB 1xr0 Chain B Binding Site BS01

Receptor Information
>1xr0 Chain B (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGSDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKW
HYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQN
NSINVVEEPVVERNNHQTELEVPRTPRTP
Ligand information
>1xr0 Chain A (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HSQMAVHKLAKSIPLRRQVTVS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1xr0 Structural Basis of SNT PTB Domain Interactions with Distinct Neurotrophic Receptors
ResolutionN/A
Binding residue
(original residue number in PDB)		N25 V26 D27 D28 L33 T49 D53 V55 W57 L60 L62 R63 R64 Y65 Y67 D68 S73 F74 Q81 T82 I86 F87 A88 F89 F98 M105 N111 V112 V113 E114 E115 P116
Binding residue
(residue number reindexed from 1)		N18 V19 D20 D21 L26 T42 D46 V48 W50 L53 L55 R56 R57 Y58 Y60 D61 S66 F67 Q74 T75 I79 F80 A81 F82 F91 M98 N104 V105 V106 E107 E108 P109
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1xr0, PDBe:1xr0, PDBj:1xr0
PDBsum1xr0
PubMed11090629
UniProtQ8WU20|FRS2_HUMAN Fibroblast growth factor receptor substrate 2 (Gene Name=FRS2)

[Back to BioLiP]