Structure of PDB 1xiu Chain B Binding Site BS01

Receptor Information

>1xiu Chain B (length=224) Species: 6526 (Biomphalaria glabrata) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NNDMPVEQILEAELAVDPKIDTYIDAQKDPVTNICQAADKQLFTLVEWAK
RIPHFTELPLEDQVILLRAGWNELLIAGFSHRSIMAKDGILLATGLHVHR
SSAHQAGVGTIFDRVLTELVAKMRDMKMDKTELGCLRAVVLFNPDAKGLT
AVQEVEQLREKVYASLEEYTKSRYPEEPGRFAKLLLRLPALRSIGLKCLE
HLFFFKLIGDQPIDTFLMEMLENP

Ligand information

>1xiu Chain F (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KILHRLLQEG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1xiu Crystal Structure of a Novel Tetrameric Complex of Agonist-bound Ligand-binding Domain of Biomphalaria glabrata Retinoid X Receptor.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	K258 F424 E427
Binding residue (residue number reindexed from 1)	K50 F216 E219

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003707	nuclear steroid receptor activity
GO:0008270	zinc ion binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1xiu, PDBe:1xiu, PDBj:1xiu
PDBsum	1xiu
PubMed	16274693
UniProt	Q8T5C6\|RXR_BIOGL Retinoic acid receptor RXR (Gene Name=RXR)

[Back to BioLiP]