Structure of PDB 1xf5 Chain B Binding Site BS01

Receptor Information
>1xf5 Chain B (length=218) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIQLVQSGPELKKPGETVKISCKASGYTFTDFSMHWVNQAPGKGLNWMGW
VNTETGEPTYADDFKGRFAFSLETSASTAYLQINSLKNEDTATYFCARFL
LRQYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGY
FPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTC
NVAHPASSTKVDKKIVPR
Ligand information
>1xf5 Chain P (length=16) Species: 11115 (Hepatitis C virus isolate HC-J8) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PGGGQIVGGVYLLPRR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1xf5 Different crystal packing in Fab-protein L semi-disordered peptide complex.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		T30 D31 F32 S33 W50 N52 T53 L101 Q103
Binding residue
(residue number reindexed from 1)		T30 D31 F32 S33 W50 N52 T53 L101 Q103
External links