Structure of PDB 1x11 Chain B Binding Site BS01

Receptor Information
>1x11 Chain B (length=122) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IIFAANYLGSTQLLVRMMQAQEAVSRIKMAQKLAKSMTEVDLFILTQRIK
VLNADTQETMMDHPLRTISYIADIGNIVVLMARYKMICHVFESEDAQLIA
QSIGQAFSVAYQEFLRANGINP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1x11 Sequence-specific recognition of the internalization motif of the Alzheimer's amyloid precursor protein by the X11 PTB domain.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Q473 Q477
Binding residue
(residue number reindexed from 1)		Q101 Q105
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1x11, PDBe:1x11, PDBj:1x11
PDBsum1x11
PubMed9321393
UniProtQ02410|APBA1_HUMAN Amyloid-beta A4 precursor protein-binding family A member 1 (Gene Name=APBA1)

[Back to BioLiP]