Structure of PDB 1x0g Chain B Binding Site BS01

Receptor Information

>1x0g Chain B (length=110) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MVELTPAAIQELERLQTHGVRRGQAAILRIQVQPSECGDWRYDLALVAEP
KPTDLLTQSQGWTIAIAAEAAELLRGLRVDYIEDLMGGAFRFHNPNASQT
CGCGMAFRVS

Ligand information

InChI=1S/2Fe.2S

NIXDOXVAJZFRNF-UHFFFAOYSA-N

SMILES

Software	SMILES
ACDLabs 10.04	[Fe]1S[Fe]S1
CACTVS 3.341 OpenEye OEToolkits 1.5.0	S1[Fe]S[Fe]1

Formula

Fe2 S2

Name

FE2/S2 (INORGANIC) CLUSTER

PDB chain

1x0g Chain C Residue 1500 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1x0g The Asymmetric IscA Homodimer with an Exposed [2Fe-2S] Cluster Suggests the Structural Basis of the Fe-S Cluster Biosynthetic Scaffold.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	C103 G104
Binding residue (residue number reindexed from 1)	C103 G104
Annotation score	4

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding
GO:0051536	iron-sulfur cluster binding
GO:0051537	2 iron, 2 sulfur cluster binding

	Biological Process
GO:0016226	iron-sulfur cluster assembly
GO:0097428	protein maturation by iron-sulfur cluster transfer

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1x0g, PDBe:1x0g, PDBj:1x0g
PDBsum	1x0g
PubMed	16730357
UniProt	Q8DLM0

[Back to BioLiP]