Structure of PDB 1wpu Chain B Binding Site BS01

Receptor Information
>1wpu Chain B (length=147) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TLHKERRIGRLSVLLLLNEAEESTQVEELERDGWKVCLGKVGSMDAHKVI
AAIETASKKSGVIQSEGYRESHALYHATMEALHGVTRGEMLLGSLLRTVG
LRFAVLRGNPYESEAEGDWIAVSLYGTIGAPIKGLEHETFGVGINHI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1wpu Crystal Structure of Activated HutP; An RNA Binding Protein that Regulates Transcription of the hut Operon in Bacillus subtilis
Resolution1.48 Å
Binding residue
(original residue number in PDB)		K41 V42 G43 S44 A53 T56 A57 K60 T99 V100 G101 L102 T128 A131 P132 I133 K134 E137
Binding residue
(residue number reindexed from 1)		K40 V41 G42 S43 A52 T55 A56 K59 T98 V99 G100 L101 T127 A130 P131 I132 K133 E136
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
Biological Process
GO:0006547 L-histidine metabolic process
GO:0010628 positive regulation of gene expression

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1wpu, PDBe:1wpu, PDBj:1wpu
PDBsum1wpu
PubMed
UniProtP10943|HUTP_BACSU Hut operon positive regulatory protein (Gene Name=hutP)

[Back to BioLiP]