Structure of PDB 1wmq Chain B Binding Site BS01

Receptor Information
>1wmq Chain B (length=143) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TLHKERRIGRLSVLLLLNETQVEELERDGWKVCLGKVGSMDAHKVIAAIE
TASKKSGVIQSEGYRESHALYHATMEALHGVTRGEMLLGSLLRTVGLRFA
VLRGNPYESEAEGDWIAVSLYGTIGAPIKGLEHETFGVGINHI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1wmq Structural basis of HutP-mediated anti-termination and roles of the Mg2+ ion and L-histidine ligand.
Resolution1.6 Å
Binding residue
(original residue number in PDB)
K41 V42 G43 S44 A53 T56 A57 T99 V100 G101 T128 P132 I133 K134 E137
Binding residue
(residue number reindexed from 1)
K36 V37 G38 S39 A48 T51 A52 T94 V95 G96 T123 P127 I128 K129 E132
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
Biological Process
GO:0006547 L-histidine metabolic process
GO:0010628 positive regulation of gene expression

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1wmq, PDBe:1wmq, PDBj:1wmq
PDBsum1wmq
PubMed15758992
UniProtP10943|HUTP_BACSU Hut operon positive regulatory protein (Gene Name=hutP)

[Back to BioLiP]