Structure of PDB 1wav Chain B Binding Site BS01

Receptor Information

>1wav Chain B (length=30) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Ligand information

>1wav Chain A (length=21) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GIVEQCCTSICSLYQLENYCN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1wav Molecular replacement study on form-B monoclinic crystal of insulin.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	C7 L11 L15 V18 C19 R22 F25 Y26 T27 P28 K29 A30
Binding residue (residue number reindexed from 1)	C7 L11 L15 V18 C19 R22 F25 Y26 T27 P28 K29 A30

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005179	hormone activity

	Cellular Component
GO:0005576	extracellular region

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:1wav, PDBe:1wav, PDBj:1wav
PDBsum	1wav
PubMed	8760462
UniProt	P01315\|INS_PIG Insulin (Gene Name=INS)

[Back to BioLiP]