Structure of PDB 1vwq Chain B Binding Site BS01

Receptor Information
>1vwq Chain B (length=121) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDS
APATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTS
GTTEANAWKSTLVGHDTFTKV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1vwq In crystals of complexes of streptavidin with peptide ligands containing the HPQ sequence the pKa of the peptide histidine is less than 3.0.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		L25 S45 A46 Y54 W79 R84 S88 T90 W108 L110
Binding residue
(residue number reindexed from 1)		L13 S33 A34 Y42 W67 R72 S76 T78 W96 L98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1vwq, PDBe:1vwq, PDBj:1vwq
PDBsum1vwq
PubMed9148939
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]