Structure of PDB 1vwf Chain B Binding Site BS01

Receptor Information
>1vwf Chain B (length=121) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDS
APATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTS
GTTEANAWKSTLVGHDTFTKV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1vwf In crystals of complexes of streptavidin with peptide ligands containing the HPQ sequence the pKa of the peptide histidine is less than 3.0.
Resolution1.92 Å
Binding residue
(original residue number in PDB)		S45 W79 S88 T90 W108
Binding residue
(residue number reindexed from 1)		S33 W67 S76 T78 W96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1vwf, PDBe:1vwf, PDBj:1vwf
PDBsum1vwf
PubMed9148939
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]