Structure of PDB 1vwc Chain B Binding Site BS01

Receptor Information
>1vwc Chain B (length=121) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDS
APATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTS
GTTEANAWKSTLVGHDTFTKV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1vwc In crystals of complexes of streptavidin with peptide ligands containing the HPQ sequence the pKa of the peptide histidine is less than 3.0.
Resolution1.86 Å
Binding residue
(original residue number in PDB)		L25 Y43 S45 W79 R84 S88 T90 W108
Binding residue
(residue number reindexed from 1)		L13 Y31 S33 W67 R72 S76 T78 W96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1vwc, PDBe:1vwc, PDBj:1vwc
PDBsum1vwc
PubMed9148939
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]