Structure of PDB 1vol Chain B Binding Site BS01

Receptor Information

>1vol Chain B (length=187) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVI
MRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFK
DFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIV
LLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI

Ligand information

>1vol Chain C (length=16) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggctataaaagggctg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1vol Crystal structure of a TFIIB-TBP-TATA-element ternary complex.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	V29 T31 F57 F74 K78 Q116 N117 F148 I152 R154 L163 T173
Binding residue (residue number reindexed from 1)	V18 T20 F46 F63 K67 Q105 N106 F137 I141 R143 L152 T162

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding

	Biological Process
GO:0006352	DNA-templated transcription initiation

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1vol, PDBe:1vol, PDBj:1vol
PDBsum	1vol
PubMed	7675079
UniProt	P28147\|TBP1_ARATH TATA-box-binding protein 1 (Gene Name=TBP1)

[Back to BioLiP]