Structure of PDB 1uut Chain B Binding Site BS01

Receptor Information
>1uut Chain B (length=195) Species: 82300 (adeno-associated virus 5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MATFYEVIVRVPFDVEEHLPGISDSFVDWVTGQIWELPPESDLNLTLVEQ
PQLTVADRIRRVFLYEWNKFSKQESKFFVQFEKGSEYFHLHTLVETSGIS
SMVLGRYVSQIRAQLVKVVFQGIEPQINDWVAITKVKKGGANKVVDSGYI
PAYLLPKVQPELQWAWTNLDEYKLAALNLEERKRLVAQFLAESSQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1uut The Nuclease Domain of Adeno-Associated Virus Rep Coordinates Replication Initiation Using Two Distinct DNA Recognition Interfaces
Resolution2.0 Å
Binding residue
(original residue number in PDB)		S25 W29 R58 R61 Y65 V119 Q121
Binding residue
(residue number reindexed from 1)		S25 W29 R58 R61 Y65 V119 Q121
Enzymatic activity
Enzyme Commision number ?
External links