Structure of PDB 1urc Chain B Binding Site BS01

Receptor Information

>1urc Chain B (length=258) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEE
YKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPE
VAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQP
ANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPE
SLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLL
NPPETLNL

Ligand information

>1urc Chain E (length=5) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RKLFG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1urc Design, synthesis, biological activity and structural analysis of cyclic peptide inhibitors targeting the substrate recruitment site of cyclin-dependent kinase complexes.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	M210 I213 W217 Q254 I281 T282 D283
Binding residue (residue number reindexed from 1)	M36 I39 W43 Q80 I107 T108 D109

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0016538	cyclin-dependent protein serine/threonine kinase regulator activity

	Biological Process
GO:0044772	mitotic cell cycle phase transition

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1urc, PDBe:1urc, PDBj:1urc
PDBsum	1urc
PubMed	15455144
UniProt	P20248\|CCNA2_HUMAN Cyclin-A2 (Gene Name=CCNA2)

[Back to BioLiP]