Structure of PDB 1ujk Chain B Binding Site BS01

Receptor Information
>1ujk Chain B (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQ
SPQEWEAIQALTVLETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSR
TSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLKKQGIVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ujk Insights into the Phosphoregulation of beta-Secretase Sorting Signal by the VHS Domain of GGA1
Resolution1.9 Å
Binding residue
(original residue number in PDB)
K87 F88 R89 N92 Y102 K131 M138
Binding residue
(residue number reindexed from 1)
K81 F82 R83 N86 Y96 K125 M132
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0031267 small GTPase binding
GO:0035091 phosphatidylinositol binding
GO:0043130 ubiquitin binding
Biological Process
GO:0006886 intracellular protein transport
Cellular Component
GO:0005802 trans-Golgi network

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1ujk, PDBe:1ujk, PDBj:1ujk
PDBsum1ujk
PubMed15117318
UniProtQ9UJY5|GGA1_HUMAN ADP-ribosylation factor-binding protein GGA1 (Gene Name=GGA1)

[Back to BioLiP]