Structure of PDB 1uhl Chain B Binding Site BS01

Receptor Information

>1uhl Chain B (length=219) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MSPEQLGMIEKLVAAQQQCNRRSFEARQQRFAHFTELAIVSVQEIVDFAK
QLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITDFSYNREDF
AKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQL
QVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVF
ALRLQDKKLPPLLSEIWDV

Ligand information

>1uhl Chain D (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

HKILHRLLQD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1uhl Crystal structure of the heterodimeric complex of LXRalpha and RXRbeta ligand-binding domains in a fully agonistic conformation
Resolution	2.9 Å
Binding residue (original residue number in PDB)	K273 R283 I287 E441
Binding residue (residue number reindexed from 1)	K50 R60 I64 E215

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

	Biological Process
GO:0006629	lipid metabolic process

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1uhl, PDBe:1uhl, PDBj:1uhl
PDBsum	1uhl
PubMed	12970175
UniProt	Q13133\|NR1H3_HUMAN Oxysterols receptor LXR-alpha (Gene Name=NR1H3)

[Back to BioLiP]