Structure of PDB 1u8h Chain B Binding Site BS01

Receptor Information
>1u8h Chain B (length=227) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWL
AIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHR
RGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPGAAAA
LGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS
SLQTYTCNVNHKPSNTKVDKRVEPKSC
Ligand information
>1u8h Chain C (length=7) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ALDKWAS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1u8h Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications
Resolution2.1 Å
Binding residue
(original residue number in PDB)
G33 Y52 D54 R95 P98 R100H V100K
Binding residue
(residue number reindexed from 1)
G33 Y54 D56 R100 P103 R113 V116
External links