Structure of PDB 1u0c Chain B Binding Site BS01

Receptor Information
>1u0c Chain B (length=152) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSCKFKHQLSLTFQVTEKTQR
RWFLDKLVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1u0c Isolation and characterization of new homing endonuclease specificities at individual target site positions.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		S332 C333 K334 Q338 Y366 R368 R370 E380 I381 K416 D437 K439 T440
Binding residue
(residue number reindexed from 1)		S31 C32 K33 Q37 Y65 R67 R69 E79 I80 K115 D136 K138 T139
Binding affinityPDBbind-CN: Kd=25nM
Enzymatic activity
Catalytic site (original residue number in PDB) G319 D320
Catalytic site (residue number reindexed from 1) G18 D19
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1u0c, PDBe:1u0c, PDBj:1u0c
PDBsum1u0c
PubMed15313605
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]