Structure of PDB 1tt5 Chain B Binding Site BS01

Receptor Information
>1tt5 Chain B (length=414) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKLDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGG
LGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAA
EFLNDRVPNCNVVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGML
ISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLELYP
PQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGDDPEHIQ
WIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVF
KIATSAYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFLQE
VLDYLTNSASLQMKSPAITATNRTLYLQSVTSIEERTRPLSKGLVDGQEL
AVADVTTPQTVLFK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1tt5 A unique E1-E2 interaction required for optimal conjugation of the ubiquitin-like protein NEDD8.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		H32 P33 S41 F44 R136 F138 I174 L193 M196 A311
Binding residue
(residue number reindexed from 1)		H24 P25 S33 F36 R128 F130 I166 L185 M188 A303
Enzymatic activity
Catalytic site (original residue number in PDB) K21 D146 C216 T217 A219
Catalytic site (residue number reindexed from 1) K13 D138 C208 T209 A211
Enzyme Commision number 6.2.1.64: E1 NEDD8-activating enzyme.
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008641 ubiquitin-like modifier activating enzyme activity
GO:0016874 ligase activity
GO:0019781 NEDD8 activating enzyme activity
GO:0019788 NEDD8 transferase activity
GO:0042802 identical protein binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0000278 mitotic cell cycle
GO:0006508 proteolysis
GO:0007113 endomitotic cell cycle
GO:0036211 protein modification process
GO:0043687 post-translational protein modification
GO:0045116 protein neddylation
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1tt5, PDBe:1tt5, PDBj:1tt5
PDBsum1tt5
PubMed15361859
UniProtQ8TBC4|UBA3_HUMAN NEDD8-activating enzyme E1 catalytic subunit (Gene Name=UBA3)

[Back to BioLiP]