Structure of PDB 1t1p Chain B Binding Site BS01

Receptor Information
>1t1p Chain B (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSDLTEALYLVCGERGFFYTKPT
Ligand information
>1t1p Chain A (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1t1p How Insulin Binds: the B-Chain alpha-Helix Contacts the L1 beta-Helix of the Insulin Receptor.
ResolutionN/A
Binding residue
(original residue number in PDB)		F1 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 Y26 T27
Binding residue
(residue number reindexed from 1)		F1 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 Y26 T27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1t1p, PDBe:1t1p, PDBj:1t1p
PDBsum1t1p
PubMed15276842
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]