Structure of PDB 1t0j Chain B Binding Site BS01

Receptor Information
>1t0j Chain B (length=187) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITR
VTADISLAKAIIERSNTRSSLAEVQSEIERIFELARTLQLVVLDADTINH
PAQLSKTSLAPIIVYVKISSPKVLQRLIKSRHLNVQMVAADKLAQCPPQE
SFDVILDENQLEDACEHLADYLEAYWKATHPPSSNRT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1t0j Structure of a complex between a voltage-gated calcium channel beta-subunit and an alpha-subunit domain.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		M245 S345 V348 L352 S355 E389 N390 L392 E393 A395
Binding residue
(residue number reindexed from 1)		M30 S120 V123 L127 S130 E158 N159 L161 E162 A164
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005245 voltage-gated calcium channel activity
Biological Process
GO:0070588 calcium ion transmembrane transport
Cellular Component
GO:0005891 voltage-gated calcium channel complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1t0j, PDBe:1t0j, PDBj:1t0j
PDBsum1t0j
PubMed15141227
UniProtQ8VGC3|CACB2_RAT Voltage-dependent L-type calcium channel subunit beta-2 (Gene Name=Cacnb2)

[Back to BioLiP]