Structure of PDB 1sza Chain B Binding Site BS01

Receptor Information
>1sza Chain B (length=140) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DTEVIVKDFNSILEELTFNSRPIITTLTKLAEENISCAQYFVDAIESRIE
KCMPKQKLYAFYALDSICKNVGSPYTIYFSRNLFNLYKRTYLLVDNTTRT
KLINMFKLWLNPNDTGLPLFEGSALEKIEQFLIKASAAAL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1sza Recognition of RNA polymerase II carboxy-terminal domain by 3'-RNA-processing factors.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		N22 R24 Y65 D68 S69 K72 N73 K104 M108 L111
Binding residue
(residue number reindexed from 1)		N19 R21 Y62 D65 S66 K69 N70 K101 M105 L108
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000993 RNA polymerase II complex binding
GO:0003729 mRNA binding
Biological Process
GO:0006369 termination of RNA polymerase II transcription
GO:0031124 mRNA 3'-end processing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1sza, PDBe:1sza, PDBj:1sza
PDBsum1sza
PubMed15241417
UniProtP39081|PCF11_YEAST Protein PCF11 (Gene Name=PCF11)

[Back to BioLiP]