Structure of PDB 1sts Chain B Binding Site BS01

Receptor Information
>1sts Chain B (length=123) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDS
APATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTS
GTTEANAWKSTLVGHDTFTKVKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1sts Topochemical catalysis achieved by structure-based ligand design.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		L25 W79 S88 T90 W108
Binding residue
(residue number reindexed from 1)		L13 W67 S76 T78 W96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1sts, PDBe:1sts, PDBj:1sts
PDBsum1sts
PubMed8537386
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]