Structure of PDB 1srs Chain B Binding Site BS01

Receptor Information
>1srs Chain B (length=80) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVAS
ETGHVYTFATRKLQPMITSETGKALIQTCL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1srs Structure of serum response factor core bound to DNA.
Resolution3.2 Å
Binding residue
(original residue number in PDB)
G142 R143 V144 I146 R156 T160 K163 R164 K170
Binding residue
(residue number reindexed from 1)
G3 R4 V5 I7 R17 T21 K24 R25 K31
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987 cis-regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0046983 protein dimerization activity
Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1srs, PDBe:1srs, PDBj:1srs
PDBsum1srs
PubMed7637780
UniProtP11831|SRF_HUMAN Serum response factor (Gene Name=SRF)

[Back to BioLiP]