Structure of PDB 1sps Chain B Binding Site BS01

Receptor Information
>1sps Chain B (length=103) Species: 11886 (Rous sarcoma virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNA
KGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNV
CPT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1sps Binding of a high affinity phosphotyrosyl peptide to the Src SH2 domain: crystal structures of the complexed and peptide-free forms.
Resolution2.7 Å
Binding residue
(original residue number in PDB)
R12 R32 S34 E35 T36 K57 H58 Y59 K60 I71 G93
Binding residue
(residue number reindexed from 1)
R11 R31 S33 E34 T35 K56 H57 Y58 K59 I70 G92
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:1sps, PDBe:1sps, PDBj:1sps
PDBsum1sps
PubMed7680960
UniProtP00524|SRC_RSVSA Tyrosine-protein kinase transforming protein Src (Gene Name=V-SRC)

[Back to BioLiP]