Structure of PDB 1sme Chain B Binding Site BS01

Receptor Information

>1sme Chain B (length=329) Species: 5833 (Plasmodium falciparum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTA
GCLTKHLYDSSKSRTYEKDGTKVEMNYVSGTVSGFFSKDLVTVGNLSLPY
KFIEVIDTNGFEPTYTASTFDGILGLGWKDLSIGSVDPIVVELKNQNKIE
NALFTFYLPVHDKHTGFLTIGGIEERFYEGPLTYEKLNHDLYWQITLDAH
VGNIMLEKANCIVDSGTSAITVPTDFLNKMLQNLDVIKVPFLPFYVTLCN
NSKLPTFEFTSENGKYTLEPEYYLQHIEDVGPGLCMLNIIGLDFPVPTFI
LGDPFMRKYFTVFDYDNHSVGIALAKKNL

Ligand information

>1sme Chain D (length=6) Species: 285516 (Streptomyces argenteolus subsp. toyonakensis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

VVVLAL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1sme Structure and inhibition of plasmepsin II, a hemoglobin-degrading enzyme from Plasmodium falciparum.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	I32 D34 G36 S37 N76 Y77 V78 S79 F111 I123 Y192 D214 G216 T217 S218 I290
Binding residue (residue number reindexed from 1)	I32 D34 G36 S37 N76 Y77 V78 S79 F111 I123 Y192 D214 G216 T217 S218 I290

Enzymatic activity

Catalytic site (original residue number in PDB)	D34 S37 N39 W41 Y77 D214 T217
Catalytic site (residue number reindexed from 1)	D34 S37 N39 W41 Y77 D214 T217
Enzyme Commision number	3.4.23.39: plasmepsin II.

Gene Ontology

	Molecular Function
GO:0004190	aspartic-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1sme, PDBe:1sme, PDBj:1sme
PDBsum	1sme
PubMed	8816746
UniProt	P46925\|PLM2_PLAFX Plasmepsin II (Gene Name=PMII)

[Back to BioLiP]