Structure of PDB 1slg Chain B Binding Site BS01

Receptor Information
>1slg Chain B (length=123) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDS
APATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTS
GTTEANAWKSTLVGHDTFTKVKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1slg Binding to protein targets of peptidic leads discovered by phage display: crystal structures of streptavidin-bound linear and cyclic peptide ligands containing the HPQ sequence
Resolution1.76 Å
Binding residue
(original residue number in PDB)		L25 S27 S45 W79 S88 T90 W108 L110
Binding residue
(residue number reindexed from 1)		L13 S15 S33 W67 S76 T78 W96 L98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1slg, PDBe:1slg, PDBj:1slg
PDBsum1slg
PubMed7492542
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]