Structure of PDB 1sfu Chain B Binding Site BS01

Receptor Information
>1sfu Chain B (length=70) Species: 132475 (Yaba-like disease virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CTVNDAEIFSLVKKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQK
EDTVKMVPSNPPKWFKNYNC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1sfu A poxvirus protein forms a complex with left-handed Z-DNA: crystal structure of a Yatapoxvirus Zalpha bound to DNA.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		K44 N47 Q48 Y51 N65 P66 P67
Binding residue
(residue number reindexed from 1)		K39 N42 Q43 Y46 N60 P61 P62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003726 double-stranded RNA adenosine deaminase activity

View graph for
Molecular Function
External links
PDB RCSB:1sfu, PDBe:1sfu, PDBj:1sfu
PDBsum1sfu
PubMed15448208
UniProtQ9DHS8|E3_YLDV Protein E3 homolog (Gene Name=34L)

[Back to BioLiP]