Structure of PDB 1sem Chain B Binding Site BS01

Receptor Information
>1sem Chain B (length=57) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPS
NYVCPYN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1sem Structural determinants of peptide-binding orientation and of sequence specificity in SH3 domains.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
F163 Q168 E172 W191 P204 N206 Y207
Binding residue
(residue number reindexed from 1)
F8 Q13 E17 W36 P49 N51 Y52
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1sem, PDBe:1sem, PDBj:1sem
PDBsum1sem
PubMed7802869
UniProtP29355|SEM5_CAEEL Sex muscle abnormal protein 5 (Gene Name=sem-5)

[Back to BioLiP]