Structure of PDB 1s5r Chain B Binding Site BS01

Receptor Information
>1s5r Chain B (length=89) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKE
AGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDA
Ligand information
>1s5r Chain A (length=23) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DFTPMDSSAVYVLSSMARQRRAS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1s5r HBP1 and Mad1 repressors bind the Sin3 corepressor PAH2 domain with opposite helical orientations.
ResolutionN/A
Binding residue
(original residue number in PDB)		E303 A307 N312 L329 L332 Y335 Q336 Q339 F376 Q378 F379 P381 D382
Binding residue
(residue number reindexed from 1)		E9 A13 N18 L35 L38 Y41 Q42 Q45 F82 Q84 F85 P87 D88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003714 transcription corepressor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1s5r, PDBe:1s5r, PDBj:1s5r
PDBsum1s5r
PubMed15235594
UniProtQ60520|SIN3A_MOUSE Paired amphipathic helix protein Sin3a (Gene Name=Sin3a)

[Back to BioLiP]