Structure of PDB 1s4v Chain B Binding Site BS01

Receptor Information
>1s4v Chain B (length=226) Species: 3988 (Ricinus communis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TVPASVDWRKKGAVTSVKDQGQCGSCWAFSTIVAVEGINQIKTNKLVSLS
EQELVDCDTDQNQGCNGGLMDYAFEFIKQRGGITTEANYPYEAYDGTCDV
SKENAPAVSIDGHENVPENDENALLKAVANQPVSVAIDAGGSDFQFYSEG
VFTGSCGTELDHGVAIVGYGTTIDGTKYWTVKNSWGPEWGEKGYIRMERG
ISDKEGLCGIAMEASYPIKKSSNNPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1s4v The 2.0 A crystal structure and substrate specificity of the KDEL-tailed cysteine endopeptidase functioning in programmed cell death of Ricinus communis endosperm.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		G24 C26 G67 G68 D161
Binding residue
(residue number reindexed from 1)		G24 C26 G67 G68 D161
Enzymatic activity
Catalytic site (original residue number in PDB) Q20 C26 H162 N183
Catalytic site (residue number reindexed from 1) Q20 C26 H162 N183
Enzyme Commision number 3.4.22.-
Gene Ontology
Molecular Function
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1s4v, PDBe:1s4v, PDBj:1s4v
PDBsum1s4v
PubMed15037072
UniProtO65039|CYSEP_RICCO Vignain (Gene Name=CYSEP)

[Back to BioLiP]