Structure of PDB 1rtf Chain B Binding Site BS01

Receptor Information
>1rtf Chain B (length=242) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IKGGLFADIASHPWQAAIFAKHGERFLCGGILISSCWILSAAHCFQERFP
PHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKS
DSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLK
EAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRNLHDACQGDSGGPLVCL
NDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1rtf The 2.3 A crystal structure of the catalytic domain of recombinant two-chain human tissue-type plasminogen activator
Resolution2.3 Å
Binding residue
(original residue number in PDB)		I16 A25 S26 R119 T120 V121 C122 E137 R206 M207
Binding residue
(residue number reindexed from 1)		I1 A10 S11 R113 T114 V115 C116 E131 R204 M205
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 Q192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1) H43 D92 Q190 G191 D192 S193 G194
Enzyme Commision number 3.4.21.68: t-plasminogen activator.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1rtf, PDBe:1rtf, PDBj:1rtf
PDBsum1rtf
PubMed8613982
UniProtP00750|TPA_HUMAN Tissue-type plasminogen activator (Gene Name=PLAT)

[Back to BioLiP]