Structure of PDB 1rsu Chain B Binding Site BS01

Receptor Information
>1rsu Chain B (length=123) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDS
APATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTS
GTTEANAWKSTLVGHDTFTKVKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1rsu Molecular interaction between the Strep-tag affinity peptide and its cognate target, streptavidin.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		G26 S27 Y43 E44 S45 A46 S52 Y54 W79 R84 S88 T90 W108 L110
Binding residue
(residue number reindexed from 1)		G14 S15 Y31 E32 S33 A34 S40 Y42 W67 R72 S76 T78 W96 L98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1rsu, PDBe:1rsu, PDBj:1rsu
PDBsum1rsu
PubMed8636976
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]