Structure of PDB 1rst Chain B Binding Site BS01

Receptor Information

>1rst Chain B (length=123) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDS
APATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTS
GTTEANAWKSTLVGHDTFTKVKP

Ligand information

>1rst Chain P (length=9) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AWRHPQFGG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1rst Molecular interaction between the Strep-tag affinity peptide and its cognate target, streptavidin.
Resolution	1.7 Å
Binding residue (original residue number in PDB)	S45 W79 R84 S88 T90 W108 L110
Binding residue (residue number reindexed from 1)	S33 W67 R72 S76 T78 W96 L98

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0009374	biotin binding

View graph for
Molecular Function

External links

PDB	RCSB:1rst, PDBe:1rst, PDBj:1rst
PDBsum	1rst
PubMed	8636976
UniProt	P22629\|SAV_STRAV Streptavidin

[Back to BioLiP]