Structure of PDB 1rlg Chain B Binding Site BS01

Receptor Information
>1rlg Chain B (length=117) Species: 2234 (Archaeoglobus fulgidus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YVRFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAE
DVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEG
ELRKELGSLVEKIKGLQ
Ligand information
>1rlg Chain D (length=25) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcucugaccgaaaggcgugaugagc
<<<<...<<....>>......>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1rlg Molecular Basis of Box C/D RNA-Protein Interactions; Cocrystal Structure of Archaeal L7Ae and a Box C/D RNA.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		K30 G31 T32 N33 E34 K37 R41 D54 I58 K79 E89 V90 C92 A93
Binding residue
(residue number reindexed from 1)		K29 G30 T31 N32 E33 K36 R40 D53 I57 K78 E88 V89 C91 A92
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0019843 rRNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1rlg, PDBe:1rlg, PDBj:1rlg
PDBsum1rlg
PubMed15130473
UniProtO29494|RL7A_ARCFU Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]