Structure of PDB 1rh6 Chain B Binding Site BS01

Receptor Information
>1rh6 Chain B (length=52) Species: 10710 (Lambdavirus lambda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYLTLQEWNARQRRPRSLETVRRWVRESRIFPPPVKDGREYLFHESAVKV
DL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1rh6 Crystal structure of the excisionase-DNA complex from bacteriophage lambda.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		R16 S17 E19 T20 R23 G38 R39
Binding residue
(residue number reindexed from 1)		R16 S17 E19 T20 R23 G38 R39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006310 DNA recombination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1rh6, PDBe:1rh6, PDBj:1rh6
PDBsum1rh6
PubMed15066428
UniProtP03699|VXIS_LAMBD Excisionase (Gene Name=xis)

[Back to BioLiP]