Structure of PDB 1r8d Chain B Binding Site BS01

Receptor Information

>1r8d Chain B (length=107) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MKYQVKQVAEISGVSIRTLHHYDNIELLNPSALTDAGYRLYSDADLERLQ
QILFFKEIGFRLDEIKEMLDHPNFDRKAALQSQKEILMKKKQRMDEMIQT
IDRTLLS

Ligand information

>1r8d Chain C (length=26) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttgaccctaacgttgcgtgattgttt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1r8d The structural mechanism for transcription activation by MerR family member multidrug transporter activation, N terminus.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	S15 R17 T18 H21 Y22 A36 Y38 K56 R61 L62
Binding residue (residue number reindexed from 1)	S15 R17 T18 H21 Y22 A36 Y38 K56 R61 L62
Binding affinity	PDBbind-CN: Kd=96nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1r8d, PDBe:1r8d, PDBj:1r8d
PDBsum	1r8d
PubMed	14985361
UniProt	P71039\|MTA_BACSU HTH-type transcriptional activator mta (Gene Name=mta)

[Back to BioLiP]