Structure of PDB 1r5i Chain B Binding Site BS01

Receptor Information
>1r5i Chain B (length=190) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAV
TELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVT
VYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQN
GDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Ligand information
>1r5i Chain C (length=13) Species: 384484 (Influenza A virus (A/swine/Hong Kong/81/1978(H3N2))) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PKYVKQNTLKLAT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1r5i Crystal structure of Mycoplasma arthritidis mitogen complexed with HLA-DR1 reveals a novel superantigen fold and a dimerized superantigen-MHC complex.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
F13 P56 D57 W61 R71 Y78 H81 N82 V85
Binding residue
(residue number reindexed from 1)
F13 P56 D57 W61 R71 Y78 H81 N82 V85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1r5i, PDBe:1r5i, PDBj:1r5i
PDBsum1r5i
PubMed14962388
UniProtP01911|DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain (Gene Name=HLA-DRB1)

[Back to BioLiP]