Structure of PDB 1r4r Chain B Binding Site BS01

Receptor Information
>1r4r Chain B (length=77) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKPARPCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCI
IDKIRRKNCPACRYRKCLQAGMNLEAR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1r4r Crystallographic Analysis of the Interaction of the Glucocorticoid Receptor with DNA
Resolution3.0 Å
Binding residue
(original residue number in PDB)		G458 S459 V462 R466 R489 K490 R496
Binding residue
(residue number reindexed from 1)		G25 S26 V29 R33 R56 K57 R63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1r4r, PDBe:1r4r, PDBj:1r4r
PDBsum1r4r
PubMed1865905
UniProtP06536|GCR_RAT Glucocorticoid receptor (Gene Name=Nr3c1)

[Back to BioLiP]