Structure of PDB 1r0n Chain B Binding Site BS01

Receptor Information
>1r0n Chain B (length=86) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDMY
MRRKCQECRLKKCLAVGMRPECVVPENQCAMKRREK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1r0n Structure of the heterodimeric Ecdysone Receptor DNA-binding complex
Resolution2.6 Å
Binding residue
(original residue number in PDB)		E219 F224 R227 R250 Q254 R257
Binding residue
(residue number reindexed from 1)		E21 F26 R29 R52 Q56 R59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1r0n, PDBe:1r0n, PDBj:1r0n
PDBsum1r0n
PubMed14592980
UniProtP34021|ECR_DROME Ecdysone receptor (Gene Name=EcR)

[Back to BioLiP]