Structure of PDB 1qzg Chain B Binding Site BS01

Receptor Information

>1qzg Chain B (length=170) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VIDSLQLNELLNAGEYKIGELTFQSIRSSQELQKKNTIVNLFGIVKDFTP
SRQSLHGTKDWVTTVYLWDPTCDTSSIGLQIHLFSKQGNDLPVIKQVGQP
LLLHQITLRSYRDRTQGLSKDQFRYALWPDFSSNSKDTLCPQPMPRLMKT
GDKEEQFALLLNKIWDEQTN

Ligand information

>1qzg Chain D (length=5) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggtta

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1qzg DNA self-recognition in the structure of Pot1 bound to telomeric single-stranded DNA
Resolution	1.9 Å
Binding residue (original residue number in PDB)	R56 S58 L59 H60 G61 T62 D64 F88 K90 T111 L122 S123 K124 D125
Binding residue (residue number reindexed from 1)	R52 S54 L55 H56 G57 T58 D60 F84 K86 T107 L118 S119 K120 D121
Binding affinity	PDBbind-CN: Kd=480nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0043047	single-stranded telomeric DNA binding

	Biological Process
GO:0000723	telomere maintenance

	Cellular Component
GO:0000781	chromosome, telomeric region

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1qzg, PDBe:1qzg, PDBj:1qzg
PDBsum	1qzg
PubMed	14614509
UniProt	O13988\|POT1_SCHPO Protection of telomeres protein 1 (Gene Name=pot1)

[Back to BioLiP]