Structure of PDB 1qtn Chain B Binding Site BS01

Receptor Information
>1qtn Chain B (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDI
LTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1qtn The atomic-resolution structure of human caspase-8, a key activator of apoptosis.
Resolution1.2 Å
Binding residue
(original residue number in PDB)		V410 S411 Y412 R413 P415 W420
Binding residue
(residue number reindexed from 1)		V21 S22 Y23 R24 P26 W31
Enzymatic activity
Enzyme Commision number 3.4.22.61: caspase-8.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1qtn, PDBe:1qtn, PDBj:1qtn
PDBsum1qtn
PubMed10508785
UniProtQ14790|CASP8_HUMAN Caspase-8 (Gene Name=CASP8)

[Back to BioLiP]