Structure of PDB 1qrv Chain B Binding Site BS01

Receptor Information
>1qrv Chain B (length=71) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DKPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSEW
EAKAAKAKDDYDRAVKEFEAN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1qrv The structure of a chromosomal high mobility group protein-DNA complex reveals sequence-neutral mechanisms important for non-sequence-specific DNA recognition.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		M13 N17
Binding residue
(residue number reindexed from 1)		M11 N15
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1qrv, PDBe:1qrv, PDBj:1qrv
PDBsum1qrv
PubMed10581235
UniProtQ05783|HMGD_DROME High mobility group protein D (Gene Name=HmgD)

[Back to BioLiP]